Identificação de proteínas do hospedeiro que interagem com a proteína NSP do geminivirus
Loading...
Date
Authors
Journal Title
Journal ISSN
Volume Title
Publisher
Universidade Federal de Viçosa
Abstract
A família Geminiviridae é uma família de vírus de planta constituída por vírus compostos por genoma circular de DNA fita simples que utilizam fatores do hospedeiro tanto para sua replicação quanto para a translocação do genoma viral no hospedeiro. Com a finalidade de identificar fatores do tomateiro que interagem com as proteínas virais do geminivírus TGMV (Tomato golden mosaic virus), foi utilizado o sistema duplo híbrido para escrutínio de proteínas positivas quanto à interação. As regiões codificadoras das proteínas MP, NSP e REn foram amplificadas e inseridas, individualmente, no vetor pBDGAL4 Cam, fusionadas ao domínio de ligação ao DNA do gene GAL4. Paralelamente foi construída uma biblioteca de cDNA de tomateiro, propagada em vetor de S. cerevisae derivados de lambda ZAPII. O escrutínio da biblioteca de cDNA assim como os ensaios funcionais de identificação de interação entre proteínas geminivirais foram conduzidos no sistema duplo-híbrido de leveduras. Ao contrário das proteínas MP e NSP, a proteína viral REn apresentou a capacidade de ativar a transcrição quando fusionada ao domínio de ligação ao DNA, o que impossibilitou seu uso como isca em ensaios de interação proteína-proteína por esse sistema. A expressão correta das proteínas de movimento MP e NSP, direcionada pelos vetores do sistema duplo-híbrido, foi comprovada pela capacidade das proteínas recombinantes em interagirem ativando os genes repórteres. A interação entre MP e NSP, identificada no presente trabalho, está coerente com os modelos propostos para movimento de geminivírus no hospedeiro, os quais sugerem a interação entre essas duas proteínas durante o processo de translocação do genoma viral. A proteína NSP foi então utilizada como isca nos ensaios de interação proteína-proteína, utilizando como alvo as proteínas codificadas pela biblioteca de cDNA de tomateiro. Como resultado do escrutínio da biblioteca de cDNA de tomateiro, foram identificados cinco cDNAs que codificam proteínas capazes de interagir com NSP com diferentes intensidades, conforme demonstrado em ensaios quantitativos da atividade do gene repórter β-galactosidase. A análise de seqüência e do padrão de restrição desses clones demonstraram que quatro deles eram idênticos e codificavam um domínio conservado de quinase serina/treonina, sendo denominado NIK (NSP - Interacting Kinase). Evidências indicam que, provavelmente, a interação entre NIK e NSP seja funcional. Análise da estrutura primária de NSP demonstrou a presença de resíduos de serina e treonina em contexto favorável para fosforilação. Além disso, NIK não foi capaz de interagir com outras proteínas virais e com controles, pelo sistema duplo híbrido, confirmando a especificidade da interação NSP-NIK. A análise comparativa da seqüência parcial do cDNA de NIK com seqüências de cDNAs de uma biblioteca de semente de soja mostrou que a proteina NIK possui cerca de 92% de similaridade de seqüência, na região carboxiterminal, com uma proteína quinase de soja. A quinase identificada em soja, denominada GmNIK (Glicine max NIK), contém 623 resíduos de aminoácidos e uma massa molecular estimada em 68586,10 kDa e foi capaz de interagir com NSP por meio do sistema duplo híbrido. GmNIK possui, além do domínio de quinase um domínio de ligação a ATP 309 419 IIHRDVKAANILL 431 , LGKGFGNVYKKGVFPDGTLVAVKK 332 , uma hélice transmembrana, provavelmente responsável pela inserção da proteína na 96 membrana plasmática, e regiões ricas em leucina, LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 167 como 144 e 192 MTQLNFLDLSYNNLSGPVPRILAKS . Os domínios encontrados em GmNIK são característicos de proteínas codificadas por genes de resistência e de receptores de membrana envolvidos em programas de desenvolvimento. A predição do modelo topológico de GmNIK baseado em sua estrutura modular, similar `aquela da proteína codificada pelo gene de resistência Xa21, sugere a posição intracelular do domínio de quinase e do domínio de ligação a nucleotídeo, enquanto que as regiões ricas em leucina são voltadas para o meio extracelular. A posição intracelular do domínio de quinase está coerente com a hipótese de interação funcional entre GmNIK e NSP, uma vez que NSP localiza- se no meio celular interno. Ensaios adicionais deverão ser conduzidos para confirmar se a proteína viral NSP é fosforilada por NIK in vitro e in vivo.
Geminiviridae is a family of plant viruses comprised by viruses with a circular single stranded DNA genome that utilizes host factors for replication and viral genome translocation. In order to identify factors in tomato plants which interact with viral proteins of the geminivirus TGMV (Tomato golden mosaic virus), the yeast two-hybrid system was used to screen for proteins with a positive interaction. Coding regions of the proteins MP, NSP and REn were amplified and inserted, individually, within the vector pBDGAL4 Cam, and merged to the DNA binding domain of the GAL4 gene. Additionally, a library of tomato cDNA was obtained and propagated in a S. cerevisae vector derived from lambda ZAPII. The cDNA library screening and all functional assays developed to identify the interaction among geminiviral proteins were carried out in the yeast two-hybrid system. Differently from the MP and NSP proteins, the REn viral protein was able to activate the transcription when merged to the DNA binding domain. Therefore, it was impossible to use the REn viral protein as an bait in protein-protein interaction assays by this system. The correct expression of the movement proteins MP and NSP, directed by the two-hybrid vectors, was demonstraded by the interaction capacity of recombinant proteins, activating its reporting genes. The interaction between MP and NSP, identified in the present work, is consistent with the models that describe the geminivirus movement within the host, which suggest the interaction between these two proteins during the viral genome translocation. The NSP protein was utilized as bait in the protein-protein interaction assays, using as target proteins codified by the tomato cDNA library. The screeninf of the library resulted in the identification of five cDNAs that code for proteins capable of interacting with NSP with different intensities, according to the quantitative assays of the reporter gene β-galactosidase. Analyses of the sequence and the restriction patterns of these clones demonstrated that four of them were identical and code for a conserved serine/threonine kinase domain, named NIK (NSP - Interacting Kinase). Evidence indicates that the interaction between NIK and NSP is probably functional. The analysis of the NSP primary structure showed the presence of serine and threonine residues suitable to phosphorylation. Besides, NIK was not able to interact with other viral proteins and with controls using the two-hybrid system, corroborating the specificity of the NSP-NIK interaction. The comparative analysis of the NIK s cDNA partial sequence with cDNAs provided from a soybean library showed that the NIK protein has a sequence similarity of about 92% with a kinase protein from soybean, in the carboxy-terminal region. The kinase identified in soybean, named GmNIK (Glicine max NIK), has 623 amino acid residues, a molecular mass around 68586.10 kDa and showed the ability of interact with NSP using the two-hybrid system. The GmNIK has a kinase domain 309 419 IIHRDVKAANILL 431 , an ATP binding domain LGKGFGNVYKKGVFPDGTLVAVKK 332 , a transmembrane helix, which is probably responsible for the introduction of the protein in the plasmatic 96 membrane, and leucine-rich regions, such as LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 144 and 167 MTQLNFLDLSYNNLSGPVPRILAKS 192 . Domains found in GmNIK are characteristic of proteins encoded by resistance genes and of membrane receptors involved in developmental programing. The prediction of a topological model of GmNIK based on its modular structure, similar to the protein encoded by the resistance gene Xa21, suggests an intracellular position of the kinase and nucleotide biding domain, while the leucine-rich regions are located in the extracellular environment. The intracellular position of the kinase domain is consistent to the hypothesis of functional interaction between GmNIK and NSP, since NSP is located inside the cell. Additional assays will be carried out in order to confirm whether the NSP viral protein is phosphorylated by NIK in vitro and in vivo.
Geminiviridae is a family of plant viruses comprised by viruses with a circular single stranded DNA genome that utilizes host factors for replication and viral genome translocation. In order to identify factors in tomato plants which interact with viral proteins of the geminivirus TGMV (Tomato golden mosaic virus), the yeast two-hybrid system was used to screen for proteins with a positive interaction. Coding regions of the proteins MP, NSP and REn were amplified and inserted, individually, within the vector pBDGAL4 Cam, and merged to the DNA binding domain of the GAL4 gene. Additionally, a library of tomato cDNA was obtained and propagated in a S. cerevisae vector derived from lambda ZAPII. The cDNA library screening and all functional assays developed to identify the interaction among geminiviral proteins were carried out in the yeast two-hybrid system. Differently from the MP and NSP proteins, the REn viral protein was able to activate the transcription when merged to the DNA binding domain. Therefore, it was impossible to use the REn viral protein as an bait in protein-protein interaction assays by this system. The correct expression of the movement proteins MP and NSP, directed by the two-hybrid vectors, was demonstraded by the interaction capacity of recombinant proteins, activating its reporting genes. The interaction between MP and NSP, identified in the present work, is consistent with the models that describe the geminivirus movement within the host, which suggest the interaction between these two proteins during the viral genome translocation. The NSP protein was utilized as bait in the protein-protein interaction assays, using as target proteins codified by the tomato cDNA library. The screeninf of the library resulted in the identification of five cDNAs that code for proteins capable of interacting with NSP with different intensities, according to the quantitative assays of the reporter gene β-galactosidase. Analyses of the sequence and the restriction patterns of these clones demonstrated that four of them were identical and code for a conserved serine/threonine kinase domain, named NIK (NSP - Interacting Kinase). Evidence indicates that the interaction between NIK and NSP is probably functional. The analysis of the NSP primary structure showed the presence of serine and threonine residues suitable to phosphorylation. Besides, NIK was not able to interact with other viral proteins and with controls using the two-hybrid system, corroborating the specificity of the NSP-NIK interaction. The comparative analysis of the NIK s cDNA partial sequence with cDNAs provided from a soybean library showed that the NIK protein has a sequence similarity of about 92% with a kinase protein from soybean, in the carboxy-terminal region. The kinase identified in soybean, named GmNIK (Glicine max NIK), has 623 amino acid residues, a molecular mass around 68586.10 kDa and showed the ability of interact with NSP using the two-hybrid system. The GmNIK has a kinase domain 309 419 IIHRDVKAANILL 431 , an ATP binding domain LGKGFGNVYKKGVFPDGTLVAVKK 332 , a transmembrane helix, which is probably responsible for the introduction of the protein in the plasmatic 96 membrane, and leucine-rich regions, such as LTNQIVLLQNNNISGPIPSELGKLKLTQLDLSNNFFSGGIPPSLGHL 144 and 167 MTQLNFLDLSYNNLSGPVPRILAKS 192 . Domains found in GmNIK are characteristic of proteins encoded by resistance genes and of membrane receptors involved in developmental programing. The prediction of a topological model of GmNIK based on its modular structure, similar to the protein encoded by the resistance gene Xa21, suggests an intracellular position of the kinase and nucleotide biding domain, while the leucine-rich regions are located in the extracellular environment. The intracellular position of the kinase domain is consistent to the hypothesis of functional interaction between GmNIK and NSP, since NSP is located inside the cell. Additional assays will be carried out in order to confirm whether the NSP viral protein is phosphorylated by NIK in vitro and in vivo.
Description
Citation
MARIANO, Andréa Cristina. Identificação de proteínas do hospedeiro que interagem com a proteína NSP do Geminivirus. 2002. 71 f. Tese (Doutorado em Genética e Melhoramento) - Universidade Federal de Viçosa, Viçosa. 2002.
